You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979731 |
---|---|
Category | Proteins |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
UniProt ID | P0A370 |
MW | 17.3 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Bacillus thuringiensis subsp. kurstaki |
Biological Activity | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370. |
Expression Region | 1022-1155 aa |
Storage | -20°C |
Note | For research use only |
98.00% | |
31.3 kDa (predicted) |