CRTAP monoclonal antibody (M01), clone 4D9

• Catalog Number: orb2291554
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CRTAP.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 4D9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006362

CRTAP monoclonal antibody (M01), clone 4D9 Western Blot analysis of CRTAP expression in HeLa.

Detection limit for recombinant GST tagged CRTAP is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.19 KDa).