You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2053637 |
---|---|
Category | Proteins |
Description | CRHR1 Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 13 kDa |
UniProt ID | P34998 |
Protein Sequence | ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI |
Source | Yeast |
NCBI | NP_001138618 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | corticotropin-releasing factor receptor 1;corticot Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
13 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
37.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
13 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
13 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
37.9 kDa | |
E.coli |
Filter by Rating