You have no items in your shopping cart.
Cart summary
CRHR1 Recombinant Protein (Human)
Catalog Number: orb2053635
| Catalog Number | orb2053635 |
|---|---|
| Category | Proteins |
| Description | CRHR1 Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 13 kDa |
| UniProt ID | P34998 |
| Protein Sequence | ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI |
| Source | Yeast |
| NCBI | NP_001138618 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | corticotropin-releasing factor receptor 1;corticot Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CRHR1 protein [orb245800]
Greater than 90% as determined by SDS-PAGE.
13 kDa
Yeast
20 μg, 100 μg, 1 mgHuman CRHR1 protein [orb244130]
Greater than 90% as determined by SDS-PAGE.
37.9 kDa
E.coli
20 μg, 100 μg, 1 mgCRHR1 Recombinant Protein (Human) [orb2053636]
Greater than 90% as determined by SDS-PAGE.
13 kDa
Yeast
1 mgCRHR1 Recombinant Protein (Human) [orb2053637]
Greater than 90% as determined by SDS-PAGE.
13 kDa
Yeast
100 μgRecombinant human Corticotropin-releasing factor receptor 1 [orb2062552]
Greater than 90% as determined by SDS-PAGE.
37.9 kDa
E.coli
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
