CRF Human Rat peptide

SKU: orb216549

Description

CRF Human Rat peptide

Images & Validation

• Application Notes:
  CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Key Properties

• Source: Synthetic
• Molecular Weight: 4575.5
• Protein Sequence: H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
• Purity: > 95%

Storage & Handling

• Storage: Shipped at 4°C. Store at -20°C for one year.
• Form/Appearance: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Corticoliberin, Corticorelin, CRF-41, CRH