CREM Rabbit Polyclonal Antibody

SKU: orb329794

Description

Rabbit polyclonal antibody to CREM

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CREM
• Target: CREM
• Protein Sequence: Synthetic peptide located within the following region: MAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELR
• Molecular Weight: 13kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ICER antibody, anti CREM-2 antibody, anti hCREM-2 antibody

WB Suggested Anti-CREM Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

CREM

UniProt

O75519

RefSeq (Protein):NP_874386