CREBZF Rabbit Polyclonal Antibody

• Catalog Number: orb575742
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CREBZF
• Target: CREBZF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CREBZF
• Protein Sequence: Synthetic peptide located within the following region: TSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCS
• UniProt ID: Q9NS37
• MW: 29kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ZF, SMILE
• Note: For research use only
• NCBI: AAD28325

WB Suggested Anti-CREBZF Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: CCRF-CEM cell lysate. CREBZF is strongly supported by BioGPS gene expression data to be expressed in Human CCRT-CEM cells.