CRABP2 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2294182
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CRABP2 protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CRABP2 (NP_001869.1, 1 a.a. ~ 138 a.a) full-length human protein.
• Protein Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001869.1

Immunofluorescence of purified MaxPab antibody to CRABP2 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of CRABP2 expression in transfected 293T cell line by CRABP2 MaxPab polyclonal antibody. Lane 1: CRABP2 transfected lysate(15.18 KDa). Lane 2: Non-transfected lysate.