CRABP2 monoclonal antibody (M01), clone 4F2

• Catalog Number: orb2294180
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CRABP2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CRABP2 (NP_001869.1, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
• Tested applications: ELISA, IF, WB
• Clone Number: 4F2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001869.1

Detection limit for recombinant GST tagged CRABP2 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CRABP2 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of CRABP2 expression in transfected 293T cell line by CRABP2 monoclonal antibody (M01), clone 4F2. Lane 1: CRABP2 transfected lysate(15.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (42.1 KDa).