You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CPN2 Rabbit Polyclonal Antibody
Catalog Number: orb581481
| Catalog Number | orb581481 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CPN2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CPN2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 60kDa |
| Target | CPN2 |
| UniProt ID | P22792 |
| Protein Sequence | Synthetic peptide located within the following region: FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL |
| NCBI | NP_001073982 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | ACBP Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-CPN2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. CPN2 is supported by BioGPS gene expression data to be expressed in HepG2.
- Item 1 of 3
- Item 1 of 2
Anti-Carboxypeptidase N 2 Antibody [orb213772]
IH, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
