CORT Rabbit Polyclonal Antibody

• Catalog Number: orb326298
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CORT
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CORT
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 2kDa
• Target: CORT
• UniProt ID: O00230
• Protein Sequence: Synthetic peptide located within the following region: MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFL
• NCBI: NP_001293
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CST-14 antibody, anti CST-17 antibody, anti C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CORT Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, CORT is supported by BioGPS gene expression data to be expressed in 721_B.