CORIN Rabbit Polyclonal Antibody

• Catalog Number: orb579864
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CORIN
• Target: CORIN
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CORIN
• Protein Sequence: Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG
• UniProt ID: Q9Y5Q5
• MW: 116 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CRN, ATC2, Lrp4, PEE5, TMPRSS10
• Research Area: Cell Biology
• Note: For research use only
• NCBI: EAW93039

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-CORIN Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.