You have no items in your shopping cart.
Cart summary
Complement C5 Protein, Rat, Recombinant (His & Myc)
Catalog Number: orb1976650
| Catalog Number | orb1976650 |
|---|---|
| Category | Proteins |
| Description | Complement C5 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 14.0 kDa and the accession number is P08650. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR |
| UniProt ID | P08650 |
| MW | 14.0 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Rat |
| Biological Activity | Complement C5 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 14.0 kDa and the accession number is P08650. |
| Expression Region | 1-77 aa |
| Storage | -20°C |
| Note | For research use only |
