You have no items in your shopping cart.
Cart summary
Item 1 of 1
CNTNAP3 Rabbit Polyclonal Antibody
Catalog Number: orb581009
| Catalog Number | orb581009 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CNTNAP3 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CNTNAP3 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 141kDa |
| Target | CNTNAP3 |
| UniProt ID | Q9BZ76 |
| Protein Sequence | Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA |
| NCBI | NP_387504 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CASPR3, CNTNAP3A Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CNTNAP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: DU145 cell lysate.
- Item 1 of 1
CNTNAP3 Rabbit Polyclonal Antibody [orb2943]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Sheep
Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
