CNOT7 monoclonal antibody (M01A), clone 2F6

• Catalog Number: orb2291206
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CNOT7.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F6
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
• NCBI: AAH60852
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CNOT7 monoclonal antibody (M01A), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa.

CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in Hela S3 NE.

CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in NIH/3T3.

CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in PC-12.

CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in Raw 264.7.

Western Blot detection against Immunogen (57.09 KDa).