You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CMA1 Rabbit Polyclonal Antibody
Catalog Number: orb584539
| Catalog Number | orb584539 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Mast Cell Chymase |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CMA1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 27kDa |
| Target | CMA1 |
| UniProt ID | P23946 |
| Protein Sequence | Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA |
| NCBI | NP_001827 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CYH, MCT1, chymase Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Rabbit Anti-CMA1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-CMA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: COLO205 cell lysate. CMA1 is supported by BioGPS gene expression data to be expressed in COLO205.
- Item 1 of 1
CMA1 Rabbit Polyclonal Antibody [orb221458]
WB
Guinea pig, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl 
- Item 1 of 2
- Item 1 of 1
