CLSTN3 Rabbit Polyclonal Antibody

• Catalog Number: orb325310
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLSTN3
• Target: CLSTN3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLSTN3
• Protein Sequence: Synthetic peptide located within the following region: QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
• UniProt ID: Q9BQT9
• MW: 106kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CSTN3 antibody, anti KIAA0726 antibody, anti
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_055533

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): THP1 Cell Lysate (N30), Antibody concentration: 3 ug/mL.

WB Suggested Anti-CLSTN3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: RPMI 8226 cell lysate.