CLPX Rabbit Polyclonal Antibody

• Catalog Number: orb585642
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLPX
• Target: CLPX
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: MFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWP
• UniProt ID: O76031
• MW: 70kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EPP2
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_006651

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. CLPX is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. CLPX is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. CLPX is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-CLPX Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. CLPX is supported by BioGPS gene expression data to be expressed in HEK293T.