Cart summary

You have no items in your shopping cart.

CLIP3 Peptide - middle region

CLIP3 Peptide - middle region

Catalog Number: orb1999352

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999352
CategoryProteins
DescriptionCLIP3 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: KAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQR
UniProt IDQ96DZ5
MW60 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesRSNL1, CLIPR59, CLIPR-59
NoteFor research use only
NCBINP_001186499.1