CLEC14A Rabbit Polyclonal Antibody

SKU: orb586963

Description

Rabbit polyclonal antibody to CLEC14A

Research Area

Cancer Biology, Cell Biology, Immunology & Inflammation, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC14A
• Target: CLEC14A
• Protein Sequence: Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL
• Molecular Weight: 54kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CEG1, EGFR-5, C14orf27

Sample Type: Fetal Brain lysates, Antibody dilution: 0.25 ug/ml.

Quick Database Links

Gene Symbol

CLEC14A

UniProt

Q86T13

RefSeq (Protein):NP_778230