CLEC14A Rabbit Polyclonal Antibody

• Catalog Number: orb586963
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLEC14A
• Target: CLEC14A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC14A
• Protein Sequence: Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL
• UniProt ID: Q86T13
• MW: 54kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CEG1, EGFR-5, C14orf27
• Research Area: Cancer Biology, Cell Biology, Immunology & Inflamm
• Note: For research use only
• NCBI: NP_778230
• Expiration Date: 12 months from date of receipt.

Sample Type: Fetal Brain lysates, Antibody dilution: 0.25 ug/ml.