You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CLDN4 MaxPab mouse polyclonal antibody (B01)
Catalog Number: orb2294199
| Catalog Number | orb2294199 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a full-length human CLDN4 protein. |
| Clonality | Polyclonal |
| Species/Host | Mouse |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | No additive |
| Immunogen | CLDN4 (NP_001296.1, 1 a.a. ~ 209 a.a) full-length human protein. |
| Protein Sequence | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
| Tested applications | FC, WB |
| Application notes | For Flow Cytometry, IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_001296.1 |
FACS analysis of negative control 293 cells (Black) and CLDN4 expressing 293 cells (Green) using CLDN4 purified MaxPab mouse polyclonal antibody.
Western Blot analysis of CLDN4 expression in transfected 293T cell line by CLDN4 MaxPab polyclonal antibody. Lane 1: CLDN4 transfected lysate(22.99 KDa). Lane 2: Non-transfected lysate.
