CKMT2 Rabbit Polyclonal Antibody

• Catalog Number: orb578084
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CKMT2
• Target: CKMT2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CKMT2
• Protein Sequence: Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA
• UniProt ID: P17540
• MW: 46kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SMTCK
• Research Area: Disease Biomarkers, Epigenetics & Chromatin, Prote
• Note: For research use only
• NCBI: NP_001816
• Expiration Date: 12 months from date of receipt.

Positive control (+): HepG2 (HG), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.

Rabbit Anti-CKMT2 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CKMT2 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.