You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294391 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CKMT1B protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | No additive |
Immunogen | CKMT1B (NP_066270.1, 1 a.a. ~ 417 a.a) full-length human protein. |
Protein Sequence | MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH |
Tested applications | IP |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_066270.1 |
Immunoprecipitation of CKMT1B transfected lysate using anti-CKMT1B MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CKMT1B MaxPab mouse polyclonal antibody (B01) (orb2294392).