CKM Rabbit Polyclonal Antibody

SKU: orb578083

Description

CKM Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CKM. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CKM. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CKM
• Target: CKM
• Protein Sequence: Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
• Molecular Weight: 43kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CKMM, M-CK, CPK-M

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CKM Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

CKM

UniProt

P06732

RefSeq (Protein):NP_001815