CISD2 Rabbit Polyclonal Antibody

• Catalog Number: orb579213
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CISD2
• Target: CISD2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CISD2
• Protein Sequence: Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL
• UniProt ID: Q8N5K1
• MW: 15kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ERIS, WFS2, ZCD2, NAF-1, Miner1
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_001008389
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CISD2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.