You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294409 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant CIDEA. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CIDEA (AAH31896, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG |
Tested applications | ELISA, IP, WB |
Clone Number | 4B9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH31896 |
Detection limit for recombinant GST tagged CIDEA is 1 ng/ml as a capture antibody.
Immunoprecipitation of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.
Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA monoclonal antibody (M01), clone 4B9. Lane 1: CIDEA transfected lysate(28.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (53.57 KDa).