CHTF18 Rabbit Polyclonal Antibody

SKU: orb583626

Description

Rabbit polyclonal antibody to CHTF18

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHTF18
• Target: CHTF18
• Protein Sequence: Synthetic peptide located within the following region: SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT
• Molecular Weight: 107kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CHL12, Ctf18, RUVBL, C16orf41, C321D2.2, C321D2.3, C321D2.4

WB Suggested Anti-CHTF18 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: PANC1 cell lysate.

Quick Database Links

Gene Symbol

CHTF18

UniProt

Q8WVB6

RefSeq (Protein):NP_071375