CHRNB2 Rabbit Polyclonal Antibody

• Catalog Number: orb331572
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHRNB2
• Target: CHRNB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Porcine, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNB2
• Protein Sequence: Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
• UniProt ID: P17787
• MW: 57kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EFNL3 antibody, anti nAChRB2 antibody
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_000739

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-CHRNB2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.