CHRNB2 Rabbit Polyclonal Antibody

• Catalog Number: orb329802
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHRNB2
• Target: CHRNB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHRNB2
• Protein Sequence: Synthetic peptide located within the following region: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD
• UniProt ID: P17787
• MW: 57kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EFNL3 antibody, anti nAChRB2 antibody
• Research Area: Cell Biology, Pharmacology & Drug Discovery, Signa
• Note: For research use only
• NCBI: NP_000739

Human kidney

WB Suggested Anti-CHRNB2 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, CHRNB2 is supported by BioGPS gene expression data to be expressed in Jurkat.