You have no items in your shopping cart.
Cart summary
Item 1 of 1
CHRNB1 Rabbit Polyclonal Antibody
Catalog Number: orb324586
| Catalog Number | orb324586 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ACHB |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACHB |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 55kDa |
| Target | CHRNB1 |
| UniProt ID | P11230 |
| Protein Sequence | Synthetic peptide located within the following region: PLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLIS |
| NCBI | NP_000738 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti CHRNB1 antibody, anti ACHRB antibody, anti CH Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1 ug/mL.
- Item 1 of 2
CHRNB1 Antibody [orb625792]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
