CHRNA10 Rabbit Polyclonal Antibody

• Catalog Number: orb575439
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHRNA10
• Target: CHRNA10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen for Anti-CHRNA10 antibody is: synthetic peptide directed towards the N-terminal region of Human ACH10
• Protein Sequence: Synthetic peptide located within the following region: SHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQT
• UniProt ID: Q9GZZ6
• MW: 49 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_065135.2

WB Suggested Anti-ACH10 antibody Titration: 1 ug/ml, Sample Type: Human MCF7 Whole Cell.