You have no items in your shopping cart.
Cart summary
Chikungunya virus (strain S27-African prototype) Non-structural protein 4 (His)
Catalog Number: orb1979526
| Catalog Number | orb1979526 |
|---|---|
| Category | Proteins |
| Description | Chikungunya virus (strain S27-African prototype) Non-structural protein 4 (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q8JUX6. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 31.1 kDa (predicted) |
| UniProt ID | Q8JUX6 |
| Protein Sequence | DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK |
| Expression System | E. coli |
| Biological Origin | CHIKV |
| Biological Activity | Chikungunya virus (strain S27-African prototype) Non-structural protein 4 (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q8JUX6. |
| Expression Region | 2228-2474 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
