CHIC1 Rabbit Polyclonal Antibody

SKU: orb325190

Description

Rabbit polyclonal antibody to CHIC1

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC1
• Target: CHIC1
• Protein Sequence: Synthetic peptide located within the following region: LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV
• Molecular Weight: 24kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti RP11-108A15.1 antibody, anti BRX antibody, anti DKFZp313P1931 antibody, anti DKFZp686F2342 antibody

WB Suggested Anti-CHIC1 Antibody Titration: 5.0 ug/mL, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

CHIC1

UniProt

Q5JSZ4

RefSeq (Protein):NP_001034929