You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294499 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant CFL1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CFL1 (AAH11005, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1A1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH11005 |
CFL1 monoclonal antibody (M04), clone 1A1 Western Blot analysis of CFL1 expression in HeLa.
CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in NIH/3T3.
CFL1 monoclonal antibody (M04), clone 1A1. Western Blot analysis of CFL1 expression in Raw 264.7.
Detection limit for recombinant GST tagged CFL1 is approximately 10 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1.5 ug/ml].
Western Blot detection against Immunogen (44 KDa).