You have no items in your shopping cart.
Cart summary
Item 1 of 1
CFHR3 Rabbit Polyclonal Antibody
Catalog Number: orb325737
| Catalog Number | orb325737 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FHR3 |
| Target | CFHR3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Equine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human FHR3 |
| Protein Sequence | Synthetic peptide located within the following region: FISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICINS |
| UniProt ID | Q02985 |
| MW | 36kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CFHR3 antibody, anti CFHL3 antibody, anti FHR Read more... |
| Note | For research use only |
| NCBI | NP_066303 |
Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 3
- Item 1 of 1
- Item 1 of 1
CFHR3 Rabbit Polyclonal Antibody (FITC) [orb2109357]
WB
Equine, Human, Rat
Rabbit
Polyclonal
FITC
100 μl
