CFAP410 Rabbit Polyclonal Antibody

SKU: orb579585

Description

Rabbit polyclonal antibody to CFAP410

Research Area

Cancer Biology, Disease Biomarkers

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C21orf2
• Target: CFAP410
• Protein Sequence: Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RDMS, SMDAX, LRRC76, YF5/A2, C21orf2

Sample Type: THP-1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Brain (BR), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

Quick Database Links

Gene Symbol

CFAP410

UniProt

O43822

RefSeq (Protein):NP_004919