You have no items in your shopping cart.
Page Not Found
Cart summary
CES1C Protein, Mouse, Recombinant
Catalog Number: orb1977357
| Catalog Number | orb1977357 |
|---|---|
| Category | Proteins |
| Description | Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. CES1C Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 58.6 kDa and the accession number is P23953. |
| Tag | Tag Free |
| Purity | 98.00% |
| MW | 58.6 kDa (predicted) |
| UniProt ID | P23953 |
| Protein Sequence | HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. CES1C Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 58.6 kDa and the accession number is P23953. |
| Expression Region | 19-550 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 4
Mouse Ces1c protein [orb246077]
Greater than 90% as determined by SDS-PAGE.
60.6 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Mouse CES1C protein [orb418954]
Greater than 90% as determined by SDS-PAGE.
58.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Ces1c protein [orb244700]
Greater than 90% as determined by SDS-PAGE.
85.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Ces1c Protein [orb1476825]
Greater than 90% as determined by SDS-PAGE.
63.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μg CES1C Protein, Mouse, Recombinant (His & Myc) [orb1977358]
98.00%
63.6 kDa (predicted)
1 mg, 100 μg, 20 μg
