CES1 Rabbit Polyclonal Antibody

• Catalog Number: orb330207
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CES1
• Target: CES1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CES1
• Protein Sequence: Synthetic peptide located within the following region: VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS
• UniProt ID: P23141
• MW: 61kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ACAT antibody, anti CEH antibody, anti CES2 a
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_001020365

WB Suggested Anti-CES1 Antibody Titration: 1.25 ug/mL, Positive Control: Transfected 293T.