You have no items in your shopping cart.
Cart summary
Item 1 of 1
LASS6 Rabbit Polyclonal Antibody
Catalog Number: orb580208
| Catalog Number | orb580208 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LASS6 |
| Target | CERS6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LASS6 |
| Protein Sequence | Synthetic peptide located within the following region: MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFM |
| UniProt ID | Q6ZMG9 |
| MW | 45kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CERS5, LASS6 |
| Note | For research use only |
| NCBI | NP_982288 |
WB Suggested Anti-LASS6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: COLO205 cell lysate. CERS6 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells.
- Item 1 of 4
LASS6 Rabbit Polyclonal Antibody [orb6302]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Gallus, Porcine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
