CENPI Rabbit Polyclonal Antibody

SKU: orb582490

Description

Rabbit polyclonal antibody to CENPI

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IF, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI
• Target: CENPI
• Protein Sequence: Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
• Molecular Weight: 87kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

LRPR1, CENP-I, FSHPRH1

Sample Type: DNA/ACA.

WB Suggested Anti-CENPI Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. CENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

Quick Database Links

Gene Symbol

CENPI

UniProt

Q92674

RefSeq (Protein):NP_006724