CEMIP Rabbit Polyclonal Antibody

SKU: orb325021

Description

Rabbit polyclonal antibody to KIAA1199

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1199
• Target: CEMIP
• Protein Sequence: Synthetic peptide located within the following region: PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD
• Molecular Weight: 153 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti TMEM2L antibody, anti CCSP1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 153 kDa is present as well as an isoform at 110 kDa and possibly a 3rd at 88 kDa.

Sample Tissue: Human OVCAR-3, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-KIAA1199 Antibody Titration: 0.2-1 ug/mL, Positive Control: COLO205 cell lysate, KIAA1199 is supported by BioGPS gene expression data to be expressed in COLO205.

Quick Database Links

Gene Symbol

CEMIP

UniProt

Q8WUJ3

RefSeq (Protein):NP_061159