CDYL Rabbit Polyclonal Antibody

SKU: orb330575

Description

Rabbit polyclonal antibody to CDYL

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: ICC, IF, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human CDYL
• Target: CDYL
• Protein Sequence: Synthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
• Molecular Weight: 60kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CDYL1 antibody, anti DKFZP586C1622 antibody, anti MGC131936 antibody

Sample Type: HeLa, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: CDYL.

Sample Type: MD MB231, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: CDYL.

WB Suggested Anti-CDYL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.

Quick Database Links

Gene Symbol

CDYL

UniProt

Q9Y232

RefSeq (Protein):NP_004815