CDT1 antibody

• Catalog Number: orb325266
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Porcine, Rabbit, Yeast
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60kDa
• Target: CDT1
• UniProt ID: Q9H211
• Protein Sequence: Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
• NCBI: NP_112190
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DUP antibody, anti RIS2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HC Suggested Anti-CDT1 antibody, Titration:2 ug/mL, Positive Control:Mouse brain stem cells.

Sample Type: 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.

WB Suggested Anti-CDT1 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.