CDSN monoclonal antibody (M01), clone 6F11

• Catalog Number: orb2294558
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDSN.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
• Tested applications: ELISA, WB
• Clone Number: 6F11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001255

Western Blot detection against Immunogen (31.24 KDa).

Detection limit for recombinant GST tagged CDSN is approximately 0.03 ng/ml as a capture antibody.