CDO1 monoclonal antibody (M09), clone 4B4

• Catalog Number: orb2294566
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDO1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CDO1 (NP_001792.2, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
• NCBI: NP_001792.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CDO1 is 3 ng/ml as a capture antibody.

Western Blot analysis of CDO1 expression in transfected 293T cell line by CDO1 monoclonal antibody (M09), clone 4B4. Lane 1: CDO1 transfected lysate(23 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).