CDKN1B monoclonal antibody (M01), clone 4B4-E6

• Catalog Number: orb2294581
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CDKN1B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B4-E6
• Tested applications: ELISA, IF, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
• NCBI: AAH01971
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CDKN1B is 0.03 ng/ml as a capture antibody.

Detection limit for recombinant GST tagged CDKN1B is 10 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CDKN1B on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 5 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between AKT1 and CDKN1B. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-CDKN1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CDKN1B expression in transfected 293T cell line by CDKN1B monoclonal antibody (M01), clone 4B4-E6. Lane 1: CDKN1B transfected lysate(22.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (47.52 KDa).