You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294596 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CDK8. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6E5 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY |
NCBI | NP_001251 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CDK8 monoclonal antibody (M02), clone 6E5 Western Blot analysis of CDK8 expression in Hela S3 NE.
CDK8 monoclonal antibody (M02), clone 6E5. Western Blot analysis of CDK8 expression in Jurkat.
CDK8 monoclonal antibody (M02), clone 6E5. Western Blot analysis of CDK8 expression in NIH/3T3.
CDK8 monoclonal antibody (M02), clone 6E5. Western Blot analysis of CDK8 expression in PC-12.
CDK8 monoclonal antibody (M02), clone 6E5. Western Blot analysis of CDK8 expression in Raw 264.7.
Detection limit for recombinant GST tagged CDK8 is approximately 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa).