You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294603 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CDK6. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CDK6 (NP_001250, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE |
Tested applications | ELISA, IF, IHC-P, PLA, WB |
Clone Number | 8H4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001250 |
CDK6 monoclonal antibody (M01), clone 8H4 Western Blot analysis of CDK6 expression in Jurkat.
CDK6 monoclonal antibody (M01), clone 8H4. Western Blot analysis of CDK6 expression in PC-12.
Detection limit for recombinant GST tagged CDK6 is 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml].
Proximity Ligation Analysis of protein-protein interactions between CDK2 and CDK6. HeLa cells were stained with anti-CDK2 rabbit purified polyclonal 1:1200 and anti-CDK6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody (M01), clone 8H4. Lane 1: CDK6 transfected lysate(36.9 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.41 KDa).