CDK5RAP3 Rabbit Polyclonal Antibody

• Catalog Number: orb585182
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDK5RAP3
• Target: CDK5RAP3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human CDK5RAP3
• Protein Sequence: Synthetic peptide located within the following region: IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA
• UniProt ID: F5H3I5
• MW: 57 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: C53, IC53, LZAP, HSF-27, MST016, PP1553, OK/SW-cl.
• Note: For research use only
• NCBI: NP_001265126.1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml.