Cdk5r1 Rabbit Polyclonal Antibody

• Catalog Number: orb573600
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Cdk5r1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat
• Reactivity: Human, Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: Cdk5r1
• UniProt ID: P61809
• Protein Sequence: Synthetic peptide located within the following region: EAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLG
• NCBI: NP_034001
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: p2, p3, p25, p35, Cdk5r, D11Bwg0379e
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Rabbit Anti-CDK5R1 Antibody, Catalog Number: orb573600, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Cdk5r1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas.